Hmdb loader
Identification
HMDB Protein ID HMDBP00986
Secondary Accession Numbers
  • 6274
  • HMDBP10548
Name Cytochrome b-c1 complex subunit 9
Synonyms
  1. Complex III subunit 9
  2. Complex III subunit X
  3. Cytochrome c1 non-heme 7 kDa protein
  4. Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
Gene Name UQCR10
Protein Type Unknown
Biological Properties
General Function Involved in ubiquinol-cytochrome-c reductase activity
Specific Function This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
mitochondrial envelope
organelle envelope
envelope
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
ubiquinol-cytochrome-c reductase activity
Process
generation of precursor metabolites and energy
electron transport chain
respiratory electron transport chain
cellular metabolic process
metabolic process
mitochondrial electron transport, ubiquinol to cytochrome c
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 22cen-q12.3
SNPs UQCR10
Gene Sequence
>192 bp
ATGGCGGCCGCGACGTTGACTTCGAAATTGTACTCCCTGCTGTTCCGCAGGACCTCCACC
TTCGCCCTCACCATCATCGTGGGCGTCATGTTCTTCGAGCGCGCCTTCGATCAAGGCGCG
GACGCTATCTACGACCACATCAACGAGGGGAAGCTGTGGAAACACATCAAGCACAAGTAT
GAGAACAAGTAG
Protein Properties
Number of Residues 63
Molecular Weight 7308.4
Theoretical pI 9.97
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytochrome b-c1 complex subunit 9
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
ENK
GenBank ID Protein 12081913
UniProtKB/Swiss-Prot ID Q9UDW1
UniProtKB/Swiss-Prot Entry Name QCR9_HUMAN
PDB IDs
GenBank Gene ID AB028598
GeneCard ID UQCR10
GenAtlas ID UQCR10
HGNC ID HGNC:30863
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed:11042152 ]
  4. Schagger H, Brandt U, Gencic S, von Jagow G: Ubiquinol-cytochrome-c reductase from human and bovine mitochondria. Methods Enzymol. 1995;260:82-96. [PubMed:8592474 ]