| Identification |
|---|
| HMDB Protein ID
| HMDBP01315 |
| Secondary Accession Numbers
| |
| Name
| ATP synthase protein 8 |
| Synonyms
|
- A6L
- F-ATPase subunit 8
|
| Gene Name
| MT-ATP8 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in hydrogen ion transmembrane transporter activity |
| Specific Function
| Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| mitochondrial proton-transporting atp synthase complex, coupling factor f(o) |
| cell part |
| membrane part |
| mitochondrial membrane part |
| Function |
| hydrogen ion transmembrane transporter activity |
| monovalent inorganic cation transmembrane transporter activity |
| inorganic cation transmembrane transporter activity |
| transporter activity |
| cation transmembrane transporter activity |
| ion transmembrane transporter activity |
| substrate-specific transmembrane transporter activity |
| transmembrane transporter activity |
| Process |
| purine ribonucleoside triphosphate biosynthetic process |
| atp synthesis coupled proton transport |
| atp biosynthetic process |
| metabolic process |
| purine nucleoside triphosphate biosynthetic process |
| purine nucleotide biosynthetic process |
| purine nucleotide metabolic process |
| nucleotide metabolic process |
| nucleoside phosphate metabolic process |
| nucleobase, nucleoside and nucleotide metabolic process |
| nucleobase, nucleoside, nucleotide and nucleic acid metabolic process |
| cellular nitrogen compound metabolic process |
| nitrogen compound metabolic process |
|
| Cellular Location
|
- Mitochondrion membrane
- Single-pass membrane protein
|
| Gene Properties |
|---|
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| MT-ATP8 |
| Gene Sequence
|
>207 bp
ATGCCCCAACTAAATACTACCGTATGGCCCACCATAATTACCCCCATACTCCTTACACTA
TTCCTCATCACCCAACTAAAAATATTAAACACAAACTACCACCTACCTCCCTCACCAAAG
CCCATAAAAATAAAAAATTATAACAAACCCTGAGAACCAAAATGAACGAAAATCTGTTCG
CTTCATTCATTGCCCCCACAATCCTAG
|
| Protein Properties |
|---|
| Number of Residues
| 68 |
| Molecular Weight
| 7991.6 |
| Theoretical pI
| 10.56 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>ATP synthase protein 8
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICS
LHSLPPQS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P03928 |
| UniProtKB/Swiss-Prot Entry Name
| ATP8_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| J01415 |
| GeneCard ID
| MT-ATP8 |
| GenAtlas ID
| MT-ATP8 |
| HGNC ID
| HGNC:7415 |
| References |
|---|
| General References
| - Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
- Anderson S, Bankier AT, Barrell BG, de Bruijn MH, Coulson AR, Drouin J, Eperon IC, Nierlich DP, Roe BA, Sanger F, Schreier PH, Smith AJ, Staden R, Young IG: Sequence and organization of the human mitochondrial genome. Nature. 1981 Apr 9;290(5806):457-65. [PubMed:7219534 ]
- Horai S, Hayasaka K, Kondo R, Tsugane K, Takahata N: Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. Proc Natl Acad Sci U S A. 1995 Jan 17;92(2):532-6. [PubMed:7530363 ]
- Moilanen JS, Finnila S, Majamaa K: Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J. Mol Biol Evol. 2003 Dec;20(12):2132-42. Epub 2003 Aug 29. [PubMed:12949126 ]
- Ingman M, Kaessmann H, Paabo S, Gyllensten U: Mitochondrial genome variation and the origin of modern humans. Nature. 2000 Dec 7;408(6813):708-13. [PubMed:11130070 ]
- Ingman M, Gyllensten U: Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines. Genome Res. 2003 Jul;13(7):1600-6. [PubMed:12840039 ]
- Coble MD, Just RS, O'Callaghan JE, Letmanyi IH, Peterson CT, Irwin JA, Parsons TJ: Single nucleotide polymorphisms over the entire mtDNA genome that increase the power of forensic testing in Caucasians. Int J Legal Med. 2004 Jun;118(3):137-46. Epub 2004 Feb 4. [PubMed:14760490 ]
- Marzuki S, Noer AS, Lertrit P, Thyagarajan D, Kapsa R, Utthanaphol P, Byrne E: Normal variants of human mitochondrial DNA and translation products: the building of a reference data base. Hum Genet. 1991 Dec;88(2):139-45. [PubMed:1757091 ]
- Rieder MJ, Taylor SL, Tobe VO, Nickerson DA: Automating the identification of DNA variations using quality-based fluorescence re-sequencing: analysis of the human mitochondrial genome. Nucleic Acids Res. 1998 Feb 15;26(4):967-73. [PubMed:9461455 ]
|
