| Identification |
| HMDB Protein ID
| HMDBP01987 |
| Secondary Accession Numbers
| |
| Name
| Apolipoprotein C-III precursor |
| Synonyms
|
- Apo-CIII
- ApoC-III
|
| Gene Name
| APOC3 |
| Protein Type
| Transporter |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| extracellular region |
| Function |
| binding |
| lipid binding |
| Process |
| physiological process |
| metabolism |
| macromolecule metabolism |
| protein metabolism |
| cellular protein metabolism |
| transport |
| cellular physiological process |
| lipid transport |
| lipoprotein metabolism |
|
| Cellular Location
|
- Secreted
|
| Gene Properties |
| Chromosome Location
| Chromosome:11 |
| Locus
| 11q23.1-q23.2 |
| SNPs
| APOC3 |
| Gene Sequence
|
>300 bp
ATGCAGCCCCGGGTACTCCTTGTTGTTGCCCTCCTGGCGCTCCTGGCCTCTGCCCGAGCT
TCAGAGGCCGAGGATGCCTCCCTTCTCAGCTTCATGCAGGGCTACATGAAGCACGCCACC
AAGACCGCCAAGGATGCACTGAGCAGCGTGCAGGAGTCCCAGGTGGCCCAGCAGGCCAGG
GGCTGGGTGACCGATGGCTTCAGTTCCCTGAAAGACTACTGGAGCACCGTTAAGGACAAG
TTCTCTGAGTTCTGGGATTTGGACCCTGAGGTCAGACCAACTTCAGCCGTGGCTGCCTGA
|
| Protein Properties |
| Number of Residues
| 99 |
| Molecular Weight
| 10852.0 |
| Theoretical pI
| 5.04 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Apolipoprotein C-III precursor
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
|
| External Links |
| GenBank ID Protein
| 178768 |
| UniProtKB/Swiss-Prot ID
| P02656 |
| UniProtKB/Swiss-Prot Entry Name
| APOC3_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| J00098 |
| GeneCard ID
| APOC3 |
| GenAtlas ID
| APOC3 |
| HGNC ID
| HGNC:610 |
| References |
| General References
| - Sharpe CR, Sidoli A, Shelley CS, Lucero MA, Shoulders CC, Baralle FE: Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance. Nucleic Acids Res. 1984 May 11;12(9):3917-32. [PubMed:6328445 ]
- Protter AA, Levy-Wilson B, Miller J, Bencen G, White T, Seilhamer JJ: Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes. DNA. 1984 Dec;3(6):449-56. [PubMed:6439535 ]
- Levy-Wilson B, Appleby V, Protter A, Auperin D, Seilhamer JJ: Isolation and DNA sequence of full-length cDNA for human preapolipoprotein CIII. DNA. 1984 Oct;3(5):359-64. [PubMed:6548954 ]
- Karathanasis SK, Zannis VI, Breslow JL: Isolation and characterization of cDNA clones corresponding to two different human apoC-III alleles. J Lipid Res. 1985 Apr;26(4):451-6. [PubMed:2989400 ]
- Hospattankar AV, Brewer HB Jr, Ronan R, Fairwell T: Amino acid sequence of human plasma apolipoprotein C-III from normolipidemic subjects. FEBS Lett. 1986 Mar 3;197(1-2):67-73. [PubMed:3949020 ]
- Brewer HB Jr, Shulman R, Herbert P, Ronan R, Wehrly K: The complete amino acid sequence of alanine apolipoprotein (apoC-3), and apolipoprotein from human plasma very low density lipoproteins. J Biol Chem. 1974 Aug 10;249(15):4975-84. [PubMed:4846755 ]
- Maeda H, Hashimoto RK, Ogura T, Hiraga S, Uzawa H: Molecular cloning of a human apoC-III variant: Thr 74----Ala 74 mutation prevents O-glycosylation. J Lipid Res. 1987 Dec;28(12):1405-9. [PubMed:3123586 ]
- von Eckardstein A, Holz H, Sandkamp M, Weng W, Funke H, Assmann G: Apolipoprotein C-III(Lys58----Glu). Identification of an apolipoprotein C-III variant in a family with hyperalphalipoproteinemia. J Clin Invest. 1991 May;87(5):1724-31. [PubMed:2022742 ]
|