Hmdb loader
Identification
HMDB Protein ID HMDBP08117
Secondary Accession Numbers
  • 13828
Name Basic leucine zipper transcriptional factor ATF-like
Synonyms
  1. B-ATF
  2. B-cell-activating transcription factor
  3. SF-HT-activated gene 2 protein
  4. SFA-2
Gene Name BATF
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Functions as a negative regulator of AP-1 mediated transcription by binding to Jun proteins. Jun/B-ATF heterodimers bind DNA preferentially at the 12-O-tetradecanoylphorbol-13- acetate response element (TRE) (consensus:5'-TGA[CG]TCA-3') and weaker at the cAMP-responsive region (CRE) (consensus:5'- GTGACGT[AC][AG]-3'), but are transcriptionally inert
Pathways Not Available
Reactions Not Available
GO Classification
Component
nucleus
intracellular membrane-bounded organelle
membrane-bounded organelle
organelle
Function
protein dimerization activity
binding
sequence-specific dna binding transcription factor activity
sequence-specific dna binding
dna binding
nucleic acid binding
protein binding
Process
regulation of transcription, dna-dependent
regulation of transcription
regulation of gene expression
regulation of macromolecule metabolic process
regulation of metabolic process
regulation of biological process
biological regulation
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 14q24.3
SNPs BATF
Gene Sequence
>378 bp
ATGCCTCACAGCTCCGACAGCAGTGACTCCAGCTTCAGCCGCTCTCCTCCCCCTGGCAAA
CAGGACTCATCTGATGATGTGAGAAGAGTTCAGAGGAGGGAGAAAAATCGTATTGCCGCC
CAGAAGAGCCGACAGAGGCAGACACAGAAGGCCGACACCCTGCACCTGGAGAGCGAAGAC
CTGGAGAAACAGAACGCGGCTCTACGCAAGGAGATCAAGCAGCTCACAGAGGAACTGAAG
TACTTCACGTCGGTGCTGAACAGCCACGAGCCCCTGTGCTCGGTGCTGGCCGCCAGCACG
CCCTCGCCCCCCGAGGTGGTGTACAGCGCCCACGCATTCCACCAACCTCATGTCAGCTCC
CCGCGCTTCCAGCCCTGA
Protein Properties
Number of Residues 125
Molecular Weight 14119.5
Theoretical pI 9.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Basic leucine zipper transcriptional factor ATF-like
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
PRFQP
GenBank ID Protein 5764706
UniProtKB/Swiss-Prot ID Q16520
UniProtKB/Swiss-Prot Entry Name BATF_HUMAN
PDB IDs Not Available
GenBank Gene ID AC007182
GeneCard ID BATF
GenAtlas ID BATF
HGNC ID HGNC:958
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  3. Dorsey MJ, Tae HJ, Sollenberger KG, Mascarenhas NT, Johansen LM, Taparowsky EJ: B-ATF: a novel human bZIP protein that associates with members of the AP-1 transcription factor family. Oncogene. 1995 Dec 7;11(11):2255-65. [PubMed:8570175 ]
  4. Hasegawa H, Utsunomiya Y, Kishimoto K, Tange Y, Yasukawa M, Fujita S: SFA-2, a novel bZIP transcription factor induced by human T-cell leukemia virus type I, is highly expressed in mature lymphocytes. Biochem Biophys Res Commun. 1996 May 6;222(1):164-70. [PubMed:8630063 ]
  5. Meyer NP, Johansen LM, Tae HJ, Budde PP, Williams KL, Taparowsky EJ: Genomic organization of human B-ATF, a target for regulation by EBV and HTLV-1. Mamm Genome. 1998 Oct;9(10):849-52. [PubMed:9745044 ]
  6. Echlin DR, Tae HJ, Mitin N, Taparowsky EJ: B-ATF functions as a negative regulator of AP-1 mediated transcription and blocks cellular transformation by Ras and Fos. Oncogene. 2000 Mar 30;19(14):1752-63. [PubMed:10777209 ]
  7. Wang X, Johansen LM, Tae HJ, Taparowsky EJ: IFP 35 forms complexes with B-ATF, a member of the AP1 family of transcription factors. Biochem Biophys Res Commun. 1996 Dec 4;229(1):316-22. [PubMed:8954125 ]