Hmdb loader

Showing Protein cAMP-dependent protein kinase inhibitor gamma (HMDBP08135)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP08135
Secondary Accession Numbers
  • 13846
Name cAMP-dependent protein kinase inhibitor gamma
Synonyms
  1. PKI-gamma
Gene Name PKIG
Protein Type Unknown
Biological Properties
General Function Involved in cAMP-dependent protein kinase inhibitor activity
Specific Function Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains
Pathways Not Available
Reactions Not Available
GO Classification
Function
enzyme regulator activity
enzyme inhibitor activity
kinase inhibitor activity
protein kinase inhibitor activity
protein serine/threonine kinase inhibitor activity
camp-dependent protein kinase inhibitor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of cellular metabolic process
regulation of phosphorus metabolic process
regulation of phosphate metabolic process
regulation of phosphorylation
regulation of kinase activity
negative regulation of kinase activity
negative regulation of protein kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 20q12-q13.1
SNPs PKIG
Gene Sequence 
>231 bp
ATGATGGAGGTCGAGTCCTCCTACTCGGACTTCATCTCCTGTGACCGGACAGGCCGTCGG
AATGCGGTCCCTGACATCCAGGGAGACTCAGAGGCTGTGAGCGTGAGGAAGCTGGCTGGA
GACATGGGCGAGCTGGCACTCGAGGGGGCAGAAGGACAGGTGGAGGGAAGCGCCCCAGAC
AAGGAAGCTGGCAACCAGCCCCAGAGCAGCGATGGGACCACCTCGTCTTGA
Protein Properties
Number of Residues 76
Molecular Weight 7910.4
Theoretical pI 3.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>cAMP-dependent protein kinase inhibitor gamma
MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPD
KEAGNQPQSSDGTTSS
GenBank ID Protein 4760551
UniProtKB/Swiss-Prot ID Q9Y2B9
UniProtKB/Swiss-Prot Entry Name IPKG_HUMAN
PDB IDs Not Available
GenBank Gene ID AB019517
GeneCard ID PKIG
GenAtlas ID PKIG
HGNC ID HGNC:9019
References
General References
  1. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  2. Zheng L, Yu L, Tu Q, Zhang M, He H, Chen W, Gao J, Yu J, Wu Q, Zhao S: Cloning and mapping of human PKIB and PKIG, and comparison of tissue expression patterns of three members of the protein kinase inhibitor family, including PKIA. Biochem J. 2000 Jul 15;349(Pt 2):403-7. [PubMed:10880337 ]
  3. Collins SP, Uhler MD: Characterization of PKIgamma, a novel isoform of the protein kinase inhibitor of cAMP-dependent protein kinase. J Biol Chem. 1997 Jul 18;272(29):18169-78. [PubMed:9218452 ]