Hmdb loader

Showing Protein Jun dimerization protein 2 (HMDBP08136)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP08136
Secondary Accession Numbers
  • 13847
Name Jun dimerization protein 2
Synonyms Not Available
Gene Name JDP2
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin
Pathways Not Available
Reactions Not Available
GO Classification
Component
nucleus
intracellular membrane-bounded organelle
membrane-bounded organelle
organelle
Function
protein dimerization activity
binding
sequence-specific dna binding transcription factor activity
sequence-specific dna binding
dna binding
nucleic acid binding
protein binding
Process
regulation of transcription, dna-dependent
regulation of transcription
regulation of gene expression
regulation of macromolecule metabolic process
regulation of metabolic process
regulation of biological process
biological regulation
Cellular Location
  1. Nucleus (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 14q24.3
SNPs JDP2
Gene Sequence 
>492 bp
ATGATGCCTGGACAGATCCCGGACCCTTCGGTGACCACAGGCTCCCTGCCAGGGCTTGGC
CCCCTGACCGGGCTCCCCAGCTCGGCCCTGACTGTGGAGGAGCTGAAATACGCTGACATC
CGCAACCTCGGGGCCATGATTGCACCCTTGCACTTCCTGGAGGTGAAACTGGGCAAGAGG
CCCCAGCCCGTGAAAAGTGAGCTAGATGAGGAAGAGGAGCGAAGGAAAAGGCGCCGGGAG
AAGAACAAAGTCGCAGCAGCCCGATGCCGGAACAAGAAGAAGGAGCGCACGGAGTTTCTG
CAGCGGGAATCCGAGCGGCTGGAACTCATGAACGCAGAGCTGAAGACCCAGATTGAGGAG
CTGAAGCAGGAGCGGCAGCAGCTCATCCTGATGCTGAACCGACACCGCCCCACCTGCATC
GTCCGGACCGACAGTGTCAAGACCCCCGAGTCAGAAGGCAACCCACTGCTCGAGCAGCTC
GAGAAGAAGTGA
Protein Properties
Number of Residues 163
Molecular Weight 18703.5
Theoretical pI 9.9
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>Jun dimerization protein 2
MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKR
PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE
LKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK
GenBank ID Protein 18181974
UniProtKB/Swiss-Prot ID Q8WYK2
UniProtKB/Swiss-Prot Entry Name JDP2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB077880
GeneCard ID JDP2
GenAtlas ID JDP2
HGNC ID HGNC:17546
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  3. Murata T, Shinozuka Y, Obata Y, Yokoyama KK: Phosphorylation of two eukaryotic transcription factors, Jun dimerization protein 2 and activation transcription factor 2, in Escherichia coli by Jun N-terminal kinase 1. Anal Biochem. 2008 May 1;376(1):115-21. doi: 10.1016/j.ab.2008.01.038. Epub 2008 Feb 6. [PubMed:18307971 ]
  4. Kawaida R, Ohtsuka T, Okutsu J, Takahashi T, Kadono Y, Oda H, Hikita A, Nakamura K, Tanaka S, Furukawa H: Jun dimerization protein 2 (JDP2), a member of the AP-1 family of transcription factor, mediates osteoclast differentiation induced by RANKL. J Exp Med. 2003 Apr 21;197(8):1029-35. [PubMed:12707301 ]
  5. Jin C, Li H, Ugai H, Murata T, Yokoyama KK: Transcriptional regulation of the c-jun gene by AP-1 repressor protein JDP2 during the differentiation of F9 cells. Nucleic Acids Res Suppl. 2002;(2):97-8. [PubMed:12903123 ]
  6. Jin C, Kato K, Chimura T, Yamasaki T, Nakade K, Murata T, Li H, Pan J, Zhao M, Sun K, Chiu R, Ito T, Nagata K, Horikoshi M, Yokoyama KK: Regulation of histone acetylation and nucleosome assembly by transcription factor JDP2. Nat Struct Mol Biol. 2006 Apr;13(4):331-8. Epub 2006 Mar 5. [PubMed:16518400 ]
  7. Lerdrup M, Holmberg C, Dietrich N, Shaulian E, Herdegen T, Jaattela M, Kallunki T: Depletion of the AP-1 repressor JDP2 induces cell death similar to apoptosis. Biochim Biophys Acta. 2005 Aug 15;1745(1):29-37. [PubMed:16026868 ]