Hmdb loader
Identification
HMDB Protein ID HMDBP08141
Secondary Accession Numbers
  • 13852
Name Potassium voltage-gated channel subfamily E member 3
Synonyms
  1. MinK-related peptide 2
  2. Minimum potassium ion channel-related peptide 2
  3. Potassium channel subunit beta MiRP2
Gene Name KCNE3
Protein Type Unknown
Biological Properties
General Function Involved in voltage-gated potassium channel activity
Specific Function Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNC4/Kv3.4 is proposed to form the subthreshold voltage-gated potassium channel in skeletal muscle and to establish the resting membrane potential (RMP) in muscle cells. Associated with KCNQ1/KCLQT1 may form the intestinal cAMP-stimulated potassium channel involved in chloride secretion
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
ion transport
cation transport
monovalent inorganic cation transport
potassium ion transport
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.4
SNPs KCNE3
Gene Sequence
>312 bp
ATGGAGACTACCAATGGAACGGAGACCTGGTATGAGAGCCTGCATGCCGTGCTGAAGGCT
CTAAATGCCACTCTTCACAGCAATTTGCTCTGCCGGCCAGGGCCAGGGCTGGGGCCAGAC
AACCAGACTGAAGAGAGGCGGGCCAGCCTACCTGGCCGTGATGACAACTCCTACATGTAC
ATTCTCTTTGTCATGTTTCTATTTGCTGTAACTGTGGGCAGCCTCATCCTGGGATACACC
CGCTCCCGCAAAGTGGACAAGCGTAGTGACCCCTATCATGTGTATATCAAGAACCGTGTG
TCTATGATCTAA
Protein Properties
Number of Residues 103
Molecular Weight 11710.3
Theoretical pI 9.01
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 58-78
Protein Sequence
>Potassium voltage-gated channel subfamily E member 3
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMY
ILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
GenBank ID Protein 4704429
UniProtKB/Swiss-Prot ID Q9Y6H6
UniProtKB/Swiss-Prot Entry Name KCNE3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF076531
GeneCard ID KCNE3
GenAtlas ID KCNE3
HGNC ID HGNC:6243
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Schroeder BC, Waldegger S, Fehr S, Bleich M, Warth R, Greger R, Jentsch TJ: A constitutively open potassium channel formed by KCNQ1 and KCNE3. Nature. 2000 Jan 13;403(6766):196-9. [PubMed:10646604 ]
  3. Melman YF, Domenech A, de la Luna S, McDonald TV: Structural determinants of KvLQT1 control by the KCNE family of proteins. J Biol Chem. 2001 Mar 2;276(9):6439-44. Epub 2000 Dec 4. [PubMed:11104781 ]
  4. Abbott GW, Butler MH, Bendahhou S, Dalakas MC, Ptacek LJ, Goldstein SA: MiRP2 forms potassium channels in skeletal muscle with Kv3.4 and is associated with periodic paralysis. Cell. 2001 Jan 26;104(2):217-31. [PubMed:11207363 ]
  5. Abbott GW, Goldstein SA: Disease-associated mutations in KCNE potassium channel subunits (MiRPs) reveal promiscuous disruption of multiple currents and conservation of mechanism. FASEB J. 2002 Mar;16(3):390-400. [PubMed:11874988 ]
  6. Dias Da Silva MR, Cerutti JM, Arnaldi LA, Maciel RM: A mutation in the KCNE3 potassium channel gene is associated with susceptibility to thyrotoxic hypokalemic periodic paralysis. J Clin Endocrinol Metab. 2002 Nov;87(11):4881-4. [PubMed:12414843 ]
  7. Delpon E, Cordeiro JM, Nunez L, Thomsen PE, Guerchicoff A, Pollevick GD, Wu Y, Kanters JK, Larsen CT, Hofman-Bang J, Burashnikov E, Christiansen M, Antzelevitch C: Functional effects of KCNE3 mutation and its role in the development of Brugada syndrome. Circ Arrhythm Electrophysiol. 2008 Aug;1(3):209-18. doi: 10.1161/CIRCEP.107.748103. [PubMed:19122847 ]
  8. Ohno S, Toyoda F, Zankov DP, Yoshida H, Makiyama T, Tsuji K, Honda T, Obayashi K, Ueyama H, Shimizu W, Miyamoto Y, Kamakura S, Matsuura H, Kita T, Horie M: Novel KCNE3 mutation reduces repolarizing potassium current and associated with long QT syndrome. Hum Mutat. 2009 Apr;30(4):557-63. doi: 10.1002/humu.20834. [PubMed:19306396 ]