Hmdb loader

Showing Protein CDC42 small effector protein 1 (HMDBP08324)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP08324
Secondary Accession Numbers
  • 14036
Name CDC42 small effector protein 1
Synonyms
  1. CDC42-binding protein SCIP1
  2. Small effector of CDC42 protein 1
Gene Name CDC42SE1
Protein Type Unknown
Biological Properties
General Function Involved in GTPase inhibitor activity
Specific Function Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Cytoplasm
  4. cytoskeleton
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21.3
SNPs CDC42SE1
Gene Sequence 
>240 bp
ATGAGTGAATTTTGGCACAAACTGGGCTGCTGTGTGGTAGAGAAACCCCAGCCGAAGAAG
AAGAGAAGACGGATTGACCGGACCATGATTGGGGAACCAATGAATTTTGTTCACCTGACT
CACATTGGCTCAGGGGAGATGGGGGCCGGAGATGGACTTGCCATGACAGGTGCAGTTCAG
GAGCAGATGAGATCCAAGGGAAACCGAGATAGGCCATGGAGCAATTCTAGGGGCTTATAG
Protein Properties
Number of Residues 79
Molecular Weight 8925.3
Theoretical pI 10.76
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>CDC42 small effector protein 1
MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQ
EQMRSKGNRDRPWSNSRGL
GenBank ID Protein 9453924
UniProtKB/Swiss-Prot ID Q9NRR8
UniProtKB/Swiss-Prot Entry Name C42S1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF187845
GeneCard ID CDC42SE1
GenAtlas ID CDC42SE1
HGNC ID HGNC:17719
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Pirone DM, Fukuhara S, Gutkind JS, Burbelo PD: SPECs, small binding proteins for Cdc42. J Biol Chem. 2000 Jul 28;275(30):22650-6. [PubMed:10816584 ]
  4. Pirone DM, Oberst MD, Stylianou D, Burbelo PD: The genomic structure of the human SPEC1 gene reveals complex splicing and close promoter proximity to the AF1q translocation gene. Gene. 2001 Aug 8;273(2):295-303. [PubMed:11595176 ]
  5. Ching KH, Kisailus AE, Burbelo PD: The role of SPECs, small Cdc42-binding proteins, in F-actin accumulation at the immunological synapse. J Biol Chem. 2005 Jun 24;280(25):23660-7. Epub 2005 Apr 19. [PubMed:15840583 ]
  6. Ching KH, Kisailus AE, Burbelo PD: Biochemical characterization of distinct regions of SPEC molecules and their role in phagocytosis. Exp Cell Res. 2007 Jan 1;313(1):10-21. Epub 2006 Sep 20. [PubMed:17045588 ]