| Identification |
| HMDB Protein ID
| HMDBP10870 |
| Secondary Accession Numbers
| |
| Name
| Urea transporter JK glycoprotein |
| Synonyms
|
Not Available
|
| Gene Name
| JK |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Involved in urea transmembrane transporter activity |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| cell part |
| membrane part |
| intrinsic to membrane |
| integral to membrane |
| Function |
| urea transmembrane transporter activity |
| transmembrane transporter activity |
| substrate-specific transmembrane transporter activity |
| transporter activity |
| amide transmembrane transporter activity |
| Process |
| amide transport |
| urea transport |
| establishment of localization |
| transport |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| JK |
| Gene Sequence
|
>112 bp
CCCAATTTTCTCAAGTGCATTGAATTCCATGCTCAGCAAATGGGACCTCCCCGTCTTCAC
CCTCCCTTTCAACATGGCGTTGTCAATGTACCTTTCAGCCACAGGACATTAG
|
| Protein Properties |
| Number of Residues
| 36 |
| Molecular Weight
| 3988.6 |
| Theoretical pI
| 7.54 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Urea transporter JK glycoprotein
PIFSSALNSMLSKWDLPVFTLPFNMALSMYLSATGH
|
| External Links |
| GenBank ID Protein
| 17225555 |
| UniProtKB/Swiss-Prot ID
| Q8WXW8 |
| UniProtKB/Swiss-Prot Entry Name
| Q8WXW8_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AF328890 |
| GeneCard ID
| JK |
| GenAtlas ID
| JK |
| HGNC ID
| HGNC:10918 |
| References |
| General References
| - Irshaid NM, Eicher NI, Hustinx H, Poole J, Olsson ML: Novel alleles at the JK blood group locus explain the absence of the erythrocyte urea transporter in European families. Br J Haematol. 2002 Feb;116(2):445-53. [PubMed:11841450 ]
|