Showing Protein Hydroxylysine kinase (HMDBP11604)
| Identification | |||||
|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11604 | ||||
| Secondary Accession Numbers | None | ||||
| Name | Hydroxylysine kinase | ||||
| Synonyms |
|
||||
| Gene Name | AGPHD1 | ||||
| Protein Type | Unknown | ||||
| Biological Properties | |||||
| General Function | Not Available | ||||
| Specific Function | Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine. | ||||
| Pathways | Not Available | ||||
| Reactions |
|
||||
| GO Classification |
|
||||
| Cellular Location | Not Available | ||||
| Gene Properties | |||||
| Chromosome Location | 15 | ||||
| Locus | 15q25.1 | ||||
| SNPs | Not Available | ||||
| Gene Sequence | Not Available | ||||
| Protein Properties | |||||
| Number of Residues | Not Available | ||||
| Molecular Weight | 41932.82 | ||||
| Theoretical pI | 6.843 | ||||
| Pfam Domain Function | Not Available | ||||
| Signals | Not Available | ||||
| Transmembrane Regions | Not Available | ||||
| Protein Sequence |
>>gi|134288871|ref|NP_001013641.2| hydroxylysine kinase isoform 1 [Homo sapiens] MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPT EYVLKISNTK |
||||
| External Links | |||||
| GenBank ID Protein | Not Available | ||||
| UniProtKB/Swiss-Prot ID | A2RU49 | ||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||
| PDB IDs | Not Available | ||||
| GenBank Gene ID | Not Available | ||||
| GeneCard ID | Not Available | ||||
| GenAtlas ID | Not Available | ||||
| HGNC ID | HGNC:34403 | ||||
| References | |||||
| General References | Not Available | ||||