Hmdb loader

Showing Protein Probable cation-transporting ATPase 13A5 (HMDBP11624)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 4 metabolites
Identification
HMDB Protein ID HMDBP11624
Secondary Accession Numbers None
Name Probable cation-transporting ATPase 13A5
Synonyms
  1. P5-ATPase isoform 5
Gene Name ATP13A5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
ATP catabolic process
ATP biosynthetic process
cation transport
Cellular Component
integral to membrane
Molecular Function
metal ion binding
ATP binding
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q29
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 137325.645
Theoretical pI 7.898
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|66730421|ref|NP_940907.2| probable cation-transporting ATPase 13A5 [Homo sapiens]
MEENSKKDHRALLNQGEEDELEVFGYRDHNVRKAFCLVASVLTCGGLLLVFYWRPQWRVW
ANCIPCPLQE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q4VNC0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:31789
References
General References Not Available