| Identification |
| HMDB Protein ID
| HMDBP11642 |
| Secondary Accession Numbers
| None |
| Name
| Chromodomain-helicase-DNA-binding protein 5 |
| Synonyms
|
- CHD-5
- ATP-dependent helicase CHD5
|
| Gene Name
| CHD5 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| May play a role in the development of the nervous system and the pathogenesis of neural tumors.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| chromatin modification |
| Cellular Component |
| nucleus |
| Molecular Function |
| metal ion binding |
| ATP binding |
| zinc ion binding |
| DNA binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p36.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 223047.795 |
| Theoretical pI
| 6.152 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|24308089|ref|NP_056372.1| chromodomain-helicase-DNA-binding protein 5 [Homo sapiens]
MRGPVGTEEELPRLFAEEMENEDEMSEEEDGGLEAFDDFFPVEPVSLPKKKKPKKLKENK
CKGKRKKKEG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8TDI0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16816 |
| References |
| General References
| Not Available |