| Identification |
| HMDB Protein ID
| HMDBP11644 |
| Secondary Accession Numbers
| None |
| Name
| Chromodomain-helicase-DNA-binding protein 7 |
| Synonyms
|
- CHD-7
- ATP-dependent helicase CHD7
|
| Gene Name
| CHD7 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Probable transcription regulator.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| adult heart development |
| T cell differentiation |
| skeletal system development |
| semicircular canal morphogenesis |
| regulation of growth hormone secretion |
| positive regulation of multicellular organism growth |
| nose development |
| inner ear morphogenesis |
| genitalia development |
| female genitalia development |
| embryonic hindlimb morphogenesis |
| cranial nerve development |
| cognition |
| blood circulation |
| artery morphogenesis |
| adult walking behavior |
| chromatin modification |
| palate development |
| limb development |
| in utero embryonic development |
| sensory perception of sound |
| central nervous system development |
| heart morphogenesis |
| face development |
| retina development in camera-type eye |
| transcription, DNA-dependent |
| regulation of transcription, DNA-dependent |
| Cellular Component |
| nucleus |
| Molecular Function |
| helicase activity |
| DNA binding |
| chromatin binding |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 8 |
| Locus
| 8q12.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 335924.85 |
| Theoretical pI
| 6.342 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|54112403|ref|NP_060250.2| chromodomain-helicase-DNA-binding protein 7 [Homo sapiens]
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTN
QNQTKLTHFD
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9P2D1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20626 |
| References |
| General References
| Not Available |