| Identification |
| HMDB Protein ID
| HMDBP11646 |
| Secondary Accession Numbers
| None |
| Name
| Chromodomain-helicase-DNA-binding protein 9 |
| Synonyms
|
- CHD-9
- ATP-dependent helicase CHD9
- Chromatin-related mesenchymal modulator
- Chromatin-remodeling factor CHROM1
- Kismet homolog 2
- PPAR-alpha-interacting complex protein 320 kDa
- Peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein
- CReMM
|
| Gene Name
| CHD9 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Acts as a transcriptional coactivator for PPARA and possibly other nuclear receptors. Proposed to be a ATP-dependent chromatin remodeling protein. Has DNA-dependent ATPase activity and binds to A/T-rich DNA. Associates with A/T-rich regulatory regions in promoters of genes that participate in the differentiation of progenitors during osteogenesis (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| small molecule metabolic process |
| cellular lipid metabolic process |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| chromatin modification |
| Cellular Component |
| cytoplasm |
| nucleoplasm |
| Molecular Function |
| ATP binding |
| DNA binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 16 |
| Locus
| 16q12.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 324052.82 |
| Theoretical pI
| 6.923 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|95147342|ref|NP_079410.4| chromodomain-helicase-DNA-binding protein 9 [Homo sapiens]
MTDPMMDFFDDANLFGETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQGTP
THQKMTDFEQ
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q3L8U1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25701 |
| References |
| General References
| Not Available |