Hmdb loader
Identification
HMDB Protein ID HMDBP11646
Secondary Accession Numbers None
Name Chromodomain-helicase-DNA-binding protein 9
Synonyms
  1. CHD-9
  2. ATP-dependent helicase CHD9
  3. Chromatin-related mesenchymal modulator
  4. Chromatin-remodeling factor CHROM1
  5. Kismet homolog 2
  6. PPAR-alpha-interacting complex protein 320 kDa
  7. Peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein
  8. CReMM
Gene Name CHD9
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acts as a transcriptional coactivator for PPARA and possibly other nuclear receptors. Proposed to be a ATP-dependent chromatin remodeling protein. Has DNA-dependent ATPase activity and binds to A/T-rich DNA. Associates with A/T-rich regulatory regions in promoters of genes that participate in the differentiation of progenitors during osteogenesis (By similarity).
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
small molecule metabolic process
cellular lipid metabolic process
regulation of transcription, DNA-dependent
transcription, DNA-dependent
chromatin modification
Cellular Component
cytoplasm
nucleoplasm
Molecular Function
ATP binding
DNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q12.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 324052.82
Theoretical pI 6.923
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|95147342|ref|NP_079410.4| chromodomain-helicase-DNA-binding protein 9 [Homo sapiens]
MTDPMMDFFDDANLFGETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQGTP
THQKMTDFEQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q3L8U1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25701
References
General References Not Available