Showing Protein ATP-dependent RNA helicase DDX25 (HMDBP11668)
| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11668 | ||||||||||||
| Secondary Accession Numbers | None | ||||||||||||
| Name | ATP-dependent RNA helicase DDX25 | ||||||||||||
| Synonyms |
|
||||||||||||
| Gene Name | DDX25 | ||||||||||||
| Protein Type | Unknown | ||||||||||||
| Biological Properties | |||||||||||||
| General Function | Not Available | ||||||||||||
| Specific Function | ATP-dependent RNA helicase. Required for mRNA export and translation regulation during spermatid development (By similarity). | ||||||||||||
| Pathways | Not Available | ||||||||||||
| Reactions |
|
||||||||||||
| GO Classification |
|
||||||||||||
| Cellular Location | Not Available | ||||||||||||
| Gene Properties | |||||||||||||
| Chromosome Location | 11 | ||||||||||||
| Locus | 11q24 | ||||||||||||
| SNPs | Not Available | ||||||||||||
| Gene Sequence | Not Available | ||||||||||||
| Protein Properties | |||||||||||||
| Number of Residues | Not Available | ||||||||||||
| Molecular Weight | 54691.51 | ||||||||||||
| Theoretical pI | 6.276 | ||||||||||||
| Pfam Domain Function | Not Available | ||||||||||||
| Signals | Not Available | ||||||||||||
| Transmembrane Regions | Not Available | ||||||||||||
| Protein Sequence |
>>gi|164419732|ref|NP_037396.3| ATP-dependent RNA helicase DDX25 [Homo sapiens] MASLLWGGDAGAAESERLNSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVD LAANSLLNKL |
||||||||||||
| External Links | |||||||||||||
| GenBank ID Protein | Not Available | ||||||||||||
| UniProtKB/Swiss-Prot ID | Q9UHL0 | ||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
| PDB IDs | |||||||||||||
| GenBank Gene ID | Not Available | ||||||||||||
| GeneCard ID | Not Available | ||||||||||||
| GenAtlas ID | Not Available | ||||||||||||
| HGNC ID | HGNC:18698 | ||||||||||||
| References | |||||||||||||
| General References | Not Available | ||||||||||||