Showing Protein Probable ATP-dependent RNA helicase DDX47 (HMDBP11678)
| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11678 | ||||||||||||
| Secondary Accession Numbers | None | ||||||||||||
| Name | Probable ATP-dependent RNA helicase DDX47 | ||||||||||||
| Synonyms |
|
||||||||||||
| Gene Name | DDX47 | ||||||||||||
| Protein Type | Unknown | ||||||||||||
| Biological Properties | |||||||||||||
| General Function | Not Available | ||||||||||||
| Specific Function | Involved in apoptosis. May have a role in rRNA processing and mRNA splicing. Associates with pre-rRNA precursors. | ||||||||||||
| Pathways | Not Available | ||||||||||||
| Reactions |
|
||||||||||||
| GO Classification |
|
||||||||||||
| Cellular Location | Not Available | ||||||||||||
| Gene Properties | |||||||||||||
| Chromosome Location | 12 | ||||||||||||
| Locus | 12p13.1 | ||||||||||||
| SNPs | Not Available | ||||||||||||
| Gene Sequence | Not Available | ||||||||||||
| Protein Properties | |||||||||||||
| Number of Residues | Not Available | ||||||||||||
| Molecular Weight | 50646.07 | ||||||||||||
| Theoretical pI | 9.103 | ||||||||||||
| Pfam Domain Function | Not Available | ||||||||||||
| Signals | Not Available | ||||||||||||
| Transmembrane Regions | Not Available | ||||||||||||
| Protein Sequence |
>>gi|20149629|ref|NP_057439.2| probable ATP-dependent RNA helicase DDX47 isoform 1 [Homo sapiens] MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQ GRDIIGLAET |
||||||||||||
| External Links | |||||||||||||
| GenBank ID Protein | Not Available | ||||||||||||
| UniProtKB/Swiss-Prot ID | Q9H0S4 | ||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
| PDB IDs | |||||||||||||
| GenBank Gene ID | Not Available | ||||||||||||
| GeneCard ID | Not Available | ||||||||||||
| GenAtlas ID | Not Available | ||||||||||||
| HGNC ID | HGNC:18682 | ||||||||||||
| References | |||||||||||||
| General References | Not Available | ||||||||||||