Showing Protein ATP-dependent RNA helicase DDX51 (HMDBP11682)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11682 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | ATP-dependent RNA helicase DDX51 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | DDX51 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | ATP-binding RNA helicase involved in the biogenesis of 60S ribosomal subunits (By similarity). | ||||||||
| Pathways | Not Available | ||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 12 | ||||||||
| Locus | 12q24.33 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 72456.645 | ||||||||
| Theoretical pI | 8.169 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|154759257|ref|NP_778236.2| ATP-dependent RNA helicase DDX51 [Homo sapiens] MALFYVARYPGPDAAAAAGPEGAEAGAHGRARALLERLQSRARERQQQREPAQTEAAAST EPATRRRRRP |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q8N8A6 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:20082 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||