Hmdb loader
Identification
HMDB Protein ID HMDBP11687
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX56
Synonyms
  1. ATP-dependent 61 kDa nucleolar RNA helicase
  2. DEAD box protein 21
  3. DEAD box protein 56
Gene Name DDX56
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May play a role in later stages of the processing of the pre-ribosomal particles leading to mature 60S ribosomal subunits. Has intrinsic ATPase activity.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
rRNA processing
Cellular Component
nucleolus
Molecular Function
ATP binding
RNA binding
nucleic acid binding
ATP-dependent helicase activity
ATP-dependent RNA helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus 7p13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 57273.97
Theoretical pI 9.22
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|380692328|ref|NP_001244118.1| probable ATP-dependent RNA helicase DDX56 isoform 2 [Homo sapiens]
MEDSEALGFEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAA
YAIPMLQLLL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NY93
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18193
References
General References Not Available