| Identification |
| HMDB Protein ID
| HMDBP11687 |
| Secondary Accession Numbers
| None |
| Name
| Probable ATP-dependent RNA helicase DDX56 |
| Synonyms
|
- ATP-dependent 61 kDa nucleolar RNA helicase
- DEAD box protein 21
- DEAD box protein 56
|
| Gene Name
| DDX56 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| May play a role in later stages of the processing of the pre-ribosomal particles leading to mature 60S ribosomal subunits. Has intrinsic ATPase activity.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| rRNA processing |
| Cellular Component |
| nucleolus |
| Molecular Function |
| ATP binding |
| RNA binding |
| nucleic acid binding |
| ATP-dependent helicase activity |
| ATP-dependent RNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 7 |
| Locus
| 7p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 57273.97 |
| Theoretical pI
| 9.22 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|380692328|ref|NP_001244118.1| probable ATP-dependent RNA helicase DDX56 isoform 2 [Homo sapiens]
MEDSEALGFEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAA
YAIPMLQLLL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NY93 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18193 |
| References |
| General References
| Not Available |