Showing Protein ATP-dependent RNA helicase DHX8 (HMDBP11706)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11706 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | ATP-dependent RNA helicase DHX8 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | DHX8 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. | ||||||||
| Pathways |
|
||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 17 | ||||||||
| Locus | 17q21.31 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 139313.305 | ||||||||
| Theoretical pI | 8.328 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|4826690|ref|NP_004932.1| ATP-dependent RNA helicase DHX8 [Homo sapiens] MAVAVAMAGALIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN TTFDTFKASL |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q14562 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | |||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:2749 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||