Showing Protein Adenylate kinase 8 (HMDBP11799)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11799 | ||||||
| Secondary Accession Numbers | None | ||||||
| Name | Adenylate kinase 8 | ||||||
| Synonyms | Not Available | ||||||
| Gene Name | AK8 | ||||||
| Protein Type | Unknown | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | Adenylate kinase. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP. | ||||||
| Pathways | Not Available | ||||||
| Reactions |
|
||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 9 | ||||||
| Locus | 9q34.13 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 54925.01 | ||||||
| Theoretical pI | 6.147 | ||||||
| Pfam Domain Function | Not Available | ||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>>gi|22749187|ref|NP_689785.1| adenylate kinase 8 [Homo sapiens] MDATIAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRI VILGPPASGK |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q96MA6 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:26526 | ||||||
| References | |||||||
| General References | Not Available | ||||||