| Identification |
| HMDB Protein ID
| HMDBP11813 |
| Secondary Accession Numbers
| None |
| Name
| Lysophospholipid acyltransferase 1 |
| Synonyms
|
- LPLAT 1
- 1-acylglycerophosphoserine O-acyltransferase
- Lysophosphatidylserine acyltransferase
- Membrane-bound O-acyltransferase domain-containing protein 1
- LPSAT
- Lyso-PS acyltransferase
- O-acyltransferase domain-containing protein 1
|
| Gene Name
| MBOAT1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Acyltransferase which mediates the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
|
| Pathways
|
- Glycerolipid metabolism
- Glycerophospholipid metabolism
- phospholipid metabolism
|
| Reactions
|
| Acyl-CoA + 1-acyl-sn-glycero-3-phosphatidylserine → Coenzyme A + 1,2-diacyl-sn-glycero-3-phosphatidylserine |
details
|
|
| GO Classification
|
| Biological Process |
| glycerophospholipid biosynthetic process |
| phosphatidylethanolamine acyl-chain remodeling |
| phosphatidylserine acyl-chain remodeling |
| Cellular Component |
| integral to membrane |
| endoplasmic reticulum membrane |
| Molecular Function |
| transferase activity, transferring acyl groups other than amino-acyl groups |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6p22.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 56556.85 |
| Theoretical pI
| 9.234 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|122937404|ref|NP_001073949.1| lysophospholipid acyltransferase 1 [Homo sapiens]
MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTS
SDVRHAVATI
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6ZNC8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21579 |
| References |
| General References
| Not Available |