| Identification |
| HMDB Protein ID
| HMDBP11962 |
| Secondary Accession Numbers
| None |
| Name
| Spastin |
| Synonyms
|
- Spastic paraplegia 4 protein
|
| Gene Name
| SPAST |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| ATP-dependent microtubule severing protein. Microtubule severing may promote reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. May also play a role in axon growth and the formation of axonal branches.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| cell cycle |
| ER to Golgi vesicle-mediated transport |
| cytokinesis, completion of separation |
| protein hexamerization |
| microtubule severing |
| microtubule bundle formation |
| nervous system development |
| protein homooligomerization |
| cell death |
| cell differentiation |
| Cellular Component |
| endosome |
| perinuclear region of cytoplasm |
| spindle |
| integral to membrane |
| cytoplasmic vesicle |
| microtubule |
| microtubule organizing center |
| nucleus |
| endoplasmic reticulum |
| Molecular Function |
| microtubule binding |
| microtubule-severing ATPase activity |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 2 |
| Locus
| 2p24-p21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 67196.545 |
| Theoretical pI
| 9.648 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|11875211|ref|NP_055761.2| spastin isoform 1 [Homo sapiens]
MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESPHKRNLYYFSYPLFVG
FALLRLVAFH
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UBP0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11233 |
| References |
| General References
| Not Available |