Hmdb loader
Identification
HMDB Protein ID HMDBP11974
Secondary Accession Numbers None
Name Methylcytosine dioxygenase TET3
Synonyms Not Available
Gene Name TET3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in epigenetic chromatin reprogramming in the zygote following fertilization. Conversion into 5hmC initiates a process leading to cytosine demethylation through deamination into 5-hydroxymethyluracil (5hmU) and subsequent replacement by unmethylated cytosine by the base excision repair system. In zygotes, DNA demethylation occurs selectively in the paternal pronucleus before the first cell division, while the adjacent maternal pronucleus and certain paternally-imprinted loci are protected from this process. Participates in DNA demethylation in the paternal pronucleus by mediating conversion of 5mC into 5hmC. Does not mediate DNA demethylation of maternal pronucleus because of the presence of DPPA3/PGC7 on maternal chromatin that prevents TET3-binding to chromatin (By similarity).
Pathways Not Available
Reactions
DNA 5-methylcytosine + Oxoglutaric acid + Oxygen → DNA 5-hydroxymethylcytosine + Succinic acid + CO(2) details
GO Classification
Biological Process
DNA demethylation
chromatin modification
DNA demethylation of male pronucleus
Cellular Component
cytoplasm
male pronucleus
Molecular Function
metal ion binding
methylcytosine dioxygenase activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2p13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 179348.305
Theoretical pI 7.341
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|149944516|ref|NP_659430.1| methylcytosine dioxygenase TET3 [Homo sapiens]
MDSGPVYHGDSRQLSASGVPVNGAREPAGPSLLGTGGPWRVDQKPDWEAAPGPAHTARLE
DAHDLVAFSA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O43151
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:28313
References
General References Not Available