| Identification |
| HMDB Protein ID
| HMDBP11976 |
| Secondary Accession Numbers
| None |
| Name
| Acyl-coenzyme A thioesterase THEM4 |
| Synonyms
|
- Acyl-CoA thioesterase THEM4
- Carboxyl-terminal modulator protein
- Thioesterase superfamily member 4
|
| Gene Name
| THEM4 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Has acyl-CoA thioesterase activity towards medium and long-chain (C14 to C18) fatty acyl-CoA substrates, and probably plays an role in mitochondrial fatty acid metabolism. Plays a role in the apoptotic process, possibly via its regulation of AKT1 activity. According to PubMed:11598301, inhibits AKT1 phosphorylation and activity. According to PubMed:17615157, enhances AKT1 activity by favoring its phosphorylation and translocation to plasma membrane.
|
| Pathways
|
- PI3K-Akt signaling pathway
|
| Reactions
|
| Palmityl-CoA + Water → Coenzyme A + Palmitic acid |
details
|
|
| GO Classification
|
| Biological Process |
| fatty acid metabolic process |
| epidermal growth factor receptor signaling pathway |
| fibroblast growth factor receptor signaling pathway |
| nerve growth factor receptor signaling pathway |
| apoptotic process |
| phosphatidylinositol-mediated signaling |
| protein kinase B signaling cascade |
| insulin receptor signaling pathway |
| Cellular Component |
| mitochondrial inner membrane |
| mitochondrial intermembrane space |
| cytosol |
| mitochondrion |
| plasma membrane |
| ruffle membrane |
| Molecular Function |
| palmitoyl-CoA hydrolase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 27129.375 |
| Theoretical pI
| 8.273 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|76159293|ref|NP_444283.2| acyl-coenzyme A thioesterase THEM4 [Homo sapiens]
MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLL
FDQFMKKCED
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5T1C6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17947 |
| References |
| General References
| Not Available |