| Identification |
| HMDB Protein ID
| HMDBP11977 |
| Secondary Accession Numbers
| None |
| Name
| Probable tRNA(His) guanylyltransferase |
| Synonyms
|
- Interphase cytoplasmic foci protein 45
- tRNA-histidine guanylyltransferase
|
| Gene Name
| THG1L |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis.
|
| Pathways
|
Not Available
|
| Reactions
|
| p-tRNA(His) + Adenosine triphosphate + Guanosine triphosphate → pppG-P-tRNA(His) + Adenosine monophosphate + Pyrophosphate |
details
|
|
| GO Classification
|
| Biological Process |
| protein homotetramerization |
| tRNA modification |
| Cellular Component |
| mitochondrion |
| Molecular Function |
| magnesium ion binding |
| ATP binding |
| GTP binding |
| tRNA binding |
| tRNA guanylyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q33.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 34830.605 |
| Theoretical pI
| 7.994 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|89242148|ref|NP_060342.2| probable tRNA(His) guanylyltransferase [Homo sapiens]
MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGR
NFHRFAEKHN
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NWX6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26053 |
| References |
| General References
| Not Available |