Showing Protein Terminal uridylyltransferase 7 (HMDBP11985)
| Identification | ||||||||
|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11985 | |||||||
| Secondary Accession Numbers | None | |||||||
| Name | Terminal uridylyltransferase 7 | |||||||
| Synonyms |
|
|||||||
| Gene Name | ZCCHC6 | |||||||
| Protein Type | Unknown | |||||||
| Biological Properties | ||||||||
| General Function | Not Available | |||||||
| Specific Function | Uridylyltransferase that mediates the terminal uridylation of some specific RNAs. Not involved in uridylation of precursor let-7 (pre-let-7) miRNA. Does not play a role in replication-dependent histone mRNA degradation. | |||||||
| Pathways | Not Available | |||||||
| Reactions |
|
|||||||
| GO Classification |
|
|||||||
| Cellular Location | Not Available | |||||||
| Gene Properties | ||||||||
| Chromosome Location | 9 | |||||||
| Locus | 9q21 | |||||||
| SNPs | Not Available | |||||||
| Gene Sequence | Not Available | |||||||
| Protein Properties | ||||||||
| Number of Residues | Not Available | |||||||
| Molecular Weight | 171227.8 | |||||||
| Theoretical pI | 6.831 | |||||||
| Pfam Domain Function | Not Available | |||||||
| Signals | Not Available | |||||||
| Transmembrane Regions | Not Available | |||||||
| Protein Sequence |
>>gi|297307111|ref|NP_001171988.1| terminal uridylyltransferase 7 isoform 1 [Homo sapiens] MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGN YGNTPRKGPC |
|||||||
| External Links | ||||||||
| GenBank ID Protein | Not Available | |||||||
| UniProtKB/Swiss-Prot ID | Q5VYS8 | |||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
| PDB IDs | Not Available | |||||||
| GenBank Gene ID | Not Available | |||||||
| GeneCard ID | Not Available | |||||||
| GenAtlas ID | Not Available | |||||||
| HGNC ID | HGNC:25817 | |||||||
| References | ||||||||
| General References | Not Available | |||||||