Showing Protein Ubiquitin-conjugating enzyme E2Q-like protein 1 (HMDBP11986)
| Identification | ||||
|---|---|---|---|---|
| HMDB Protein ID | HMDBP11986 | |||
| Secondary Accession Numbers | None | |||
| Name | Ubiquitin-conjugating enzyme E2Q-like protein 1 | |||
| Synonyms | Not Available | |||
| Gene Name | UBE2QL1 | |||
| Protein Type | Unknown | |||
| Biological Properties | ||||
| General Function | Not Available | |||
| Specific Function | Catalyzes the covalent attachment of ubiquitin to other proteins (Potential). | |||
| Pathways |
|
|||
| Reactions |
|
|||
| GO Classification |
|
|||
| Cellular Location | Not Available | |||
| Gene Properties | ||||
| Chromosome Location | 5 | |||
| Locus | 5p15.31 | |||
| SNPs | Not Available | |||
| Gene Sequence | Not Available | |||
| Protein Properties | ||||
| Number of Residues | Not Available | |||
| Molecular Weight | 18337.93 | |||
| Theoretical pI | 7.961 | |||
| Pfam Domain Function | Not Available | |||
| Signals | Not Available | |||
| Transmembrane Regions | Not Available | |||
| Protein Sequence |
>>gi|223555979|ref|NP_001138633.1| ubiquitin-conjugating enzyme E2Q-like protein 1 [Homo sapiens] MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD NFPFSPPFMR |
|||
| External Links | ||||
| GenBank ID Protein | Not Available | |||
| UniProtKB/Swiss-Prot ID | A1L167 | |||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||
| PDB IDs | Not Available | |||
| GenBank Gene ID | Not Available | |||
| GeneCard ID | Not Available | |||
| GenAtlas ID | Not Available | |||
| HGNC ID | HGNC:37269 | |||
| References | ||||
| General References | Not Available | |||