| Identification |
| HMDB Protein ID
| HMDBP11989 |
| Secondary Accession Numbers
| None |
| Name
| Ubiquitin-conjugating enzyme E2 G2 |
| Synonyms
|
- Ubiquitin carrier protein G2
- Ubiquitin-protein ligase G2
|
| Gene Name
| UBE2G2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Involved in endoplasmic reticulum-associated degradation (ERAD).
|
| Pathways
|
- Parkinson disease
- Protein processing in endoplasmic reticulum
- protein ubiquitination
- Ubiquitin mediated proteolysis
|
| Reactions
|
| Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine |
details
|
|
| GO Classification
|
| Biological Process |
| protein N-linked glycosylation via asparagine |
| ER-associated protein catabolic process |
| protein K48-linked ubiquitination |
| Cellular Component |
| cytosol |
| endoplasmic reticulum |
| Molecular Function |
| ATP binding |
| ubiquitin-protein ligase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 21 |
| Locus
| 21q22.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 10762.16 |
| Theoretical pI
| 5.158 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|321117279|ref|NP_001189418.1| ubiquitin-conjugating enzyme E2 G2 isoform 3 [Homo sapiens]
MRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEP
NDESGANVDA
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P60604 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:12483 |
| References |
| General References
| Not Available |