| Identification |
| HMDB Protein ID
| HMDBP11995 |
| Secondary Accession Numbers
| None |
| Name
| Ubiquitin-associated and SH3 domain-containing protein B |
| Synonyms
|
- Cbl-interacting protein p70
- Suppressor of T-cell receptor signaling 1
- T-cell ubiquitin ligand 2
- Tyrosine-protein phosphatase STS1/TULA2
- STS-1
- TULA-2
|
| Gene Name
| UBASH3B |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Exhibits tyrosine phosphatase activity toward several substrates including EGFR, FAK, SYK, and ZAP70. Down-regulates proteins that are dually modified by both protein tyrosine phosphorylation and ubiquitination.
|
| Pathways
|
Not Available
|
| Reactions
|
| Protein tyrosine phosphate + Water → protein tyrosine + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| peptidyl-tyrosine dephosphorylation |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| protein tyrosine phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 11 |
| Locus
| 11q24.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 72695.32 |
| Theoretical pI
| 6.927 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|24497612|ref|NP_116262.2| ubiquitin-associated and SH3 domain-containing protein B [Homo sapiens]
MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAAC
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8TF42 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:29884 |
| References |
| General References
| Not Available |