Hmdb loader

Showing Protein Probable palmitoyltransferase ZDHHC14 (HMDBP12014)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 2 metabolites
Identification
HMDB Protein ID HMDBP12014
Secondary Accession Numbers None
Name Probable palmitoyltransferase ZDHHC14
Synonyms
  1. NEW1 domain-containing protein
  2. Zinc finger DHHC domain-containing protein 14
  3. NEW1CP
  4. DHHC-14
Gene Name ZDHHC14
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions
Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A details
GO Classification
Cellular Component
integral to membrane
Molecular Function
metal ion binding
zinc ion binding
transferase activity, transferring acyl groups
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q25.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 53387.945
Theoretical pI 8.239
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|24371241|ref|NP_078906.2| probable palmitoyltransferase ZDHHC14 isoform 1 [Homo sapiens]
MPPGGGGPMKDCEYSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQ
TGVFYLTLVL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IZN3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20341
References
General References Not Available