Hmdb loader

Showing Protein Palmitoyltransferase ZDHHC15 (HMDBP12015)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 2 metabolites
Identification
HMDB Protein ID HMDBP12015
Secondary Accession Numbers None
Name Palmitoyltransferase ZDHHC15
Synonyms
  1. Zinc finger DHHC domain-containing protein 15
  2. DHHC-15
Gene Name ZDHHC15
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Palmitoyltransferase specific for GAP43 and DLG4/PSD95 (By similarity).
Pathways Not Available
Reactions
Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A details
GO Classification
Biological Process
establishment of protein localization
protein palmitoylation
synaptic vesicle maturation
Cellular Component
integral to membrane
Molecular Function
metal ion binding
zinc ion binding
palmitoyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Xq13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 38405.425
Theoretical pI 8.098
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|226342941|ref|NP_001139728.1| palmitoyltransferase ZDHHC15 isoform 2 [Homo sapiens]
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVIYLILYHAIFVFFT
WTYWKSIFTL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96MV8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20342
References
General References Not Available