Showing Protein Palmitoyltransferase ZDHHC18 (HMDBP12018)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP12018 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Palmitoyltransferase ZDHHC18 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | ZDHHC18 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Has palmitoyltransferase activity towards HRAS and LCK (By similarity). | ||||||||
| Pathways | Not Available | ||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 1 | ||||||||
| Locus | 1p36.11 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 42030.225 | ||||||||
| Theoretical pI | 9.043 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|45433499|ref|NP_115659.1| palmitoyltransferase ZDHHC18 [Homo sapiens] MKDCEYQQISPGAAPLPASPGARRPGPAASPTPGPGPAPPAAPAPPRWSSSGSGSGSGSG SLGRRPRRKW |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q9NUE0 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:20712 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||