Showing Protein Probable palmitoyltransferase ZDHHC23 (HMDBP12023)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP12023 | ||||||
| Secondary Accession Numbers | None | ||||||
| Name | Probable palmitoyltransferase ZDHHC23 | ||||||
| Synonyms |
|
||||||
| Gene Name | ZDHHC23 | ||||||
| Protein Type | Unknown | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | May be involved in NOS1 regulation and targeting to the synaptic membrane (By similarity). | ||||||
| Pathways | Not Available | ||||||
| Reactions |
|
||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 3 | ||||||
| Locus | 3q13.31 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 45982.48 | ||||||
| Theoretical pI | 8.631 | ||||||
| Pfam Domain Function | Not Available | ||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>>gi|50234886|ref|NP_775841.2| probable palmitoyltransferase ZDHHC23 [Homo sapiens] MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKS LQPETCERIM |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q8IYP9 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:28654 | ||||||
| References | |||||||
| General References | Not Available | ||||||